PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC4461_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 433aa    MW: 48262.7 Da    PI: 7.9503
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC4461_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1291.7e-40179254277
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 CqvegC+ dls+ak+yhr+h++Ce hsk p+v+vsg+e+rfCqqCsrfh lsefDe+krsCrrrL++hn+rrrk++
  RrC4461_p2 179 CQVEGCNLDLSSAKDYHRKHRICENHSKFPKVVVSGVERRFCQQCSRFHCLSEFDEKKRSCRRRLSDHNARRRKPN 254
                 **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-32173240IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.821176253IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-38177257IPR004333Transcription factor, SBP-box
PfamPF031103.3E-31179252IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MECNAKPSLQ WEWDNLISFG TSSAEIPRKQ RPMDWENDGF DCTTFYSSSF ATVAAYGGSS  60
GGSDLAHAFS KSSKSTSISS SSAEVRTHNF TSEAGESLPP GSSEEFAMGI DTSPSLELSF  120
GSDDPVLGLK LGKRTYFEDF WEVENAKGSA LPVVSLASSS ASPVKKSKPV SHKLQAPHCQ  180
VEGCNLDLSS AKDYHRKHRI CENHSKFPKV VVSGVERRFC QQCSRFHCLS EFDEKKRSCR  240
RRLSDHNARR RKPNPGRTYD GKQQMDFVWN RFALIHPRSE EKFLWPNPKP VPSRGLLQEP  300
AKTEMPNKLF TEQCGFGLLD PKTKATRAEL FSKDFLEKVT ISSHMGTSQD LDGALSLLSN  360
STPWVSSDQP RRFSLNHHST SNLQPVVHGS VNQLNSVSSY WQPDPPAVEG STALPRNGEG  420
QYNENYSLNQ FYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-261792521184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1234251KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013653666.10.0PREDICTED: squamosa promoter-binding-like protein 2 isoform X2
RefseqXP_013653667.10.0PREDICTED: squamosa promoter-binding-like protein 2 isoform X2
SwissprotQ9S8400.0SPL2_ARATH; Squamosa promoter-binding-like protein 2
TrEMBLA0A078ICF20.0A0A078ICF2_BRANA; BnaC07g17030D protein
STRINGscaffold_800740.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65622644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.30.0squamosa promoter binding protein-like 2